OTC Antibody - N-terminal region (ARP41766_T100)

Catalog No: ARP41766_T100

Host: Rabbit
Target Name: OTC
Sample Tissue: Human HepG2
Antibody Dilution: 1.0ug/ml

Rabbit Anti-OTC Antibody
Catalog Number: ARP41766
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTC
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-OTC (ARP41766_T100) antibody is Catalog # AAP41766 (Previous Catalog # AAPP10814)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Tanaka,A., (2005) J. Gastroenterol. 40 (1), 106-107
• Publications:

  Hallows, W. C. et al. Sirt3 promotes the urea cycle and fatty acid oxidation during dietary restriction. Mol. Cell 41, 139-49 (2011). 21255725

  Walters, M. W. & Wallace, K. B. Urea cycle gene expression is suppressed by PFOA treatment in rats. Toxicol. Lett. 197, 46-50 (2010). 20452409

  Yu, W. et al. Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals. J. Biol. Chem. 284, 13669-75 (2009). 19318352

Target Info

• Gene Symbol: OTC
• Gene Full Name: Ornithine carbamoyltransferase
• Alias Symbols: OCTD, OTCD
• NCBI Gene Id: 5009
• Protein Name: Ornithine carbamoyltransferase, mitochondrial
• Description of Target: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.
• Uniprot ID: P00480
• Protein Accession #: NP_000522
• Nucleotide Accession #: NM_000531
• Protein Size (# AA): 354
• Molecular Weight: 40 kDa
• Protein Interactions: OTC; TOMM20;