LBP Antibody - C-terminal region (ARP41546_P050)

• Product Number: ARP41546_P050
• Name: LBP Antibody - C-terminal region (ARP41546_P050)
• Protein Size (# AA): 481 amino acids
• Molecular Weight: 53 kDa
• NCBI Gene Id: 3929
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Lipopolysaccharide binding protein
• Description:
  View product citations for LBP Antibody - C-terminal region (ARP41546_P050) on CiteAb
• Alias Symbols: BPIFD2
• Peptide Sequence: Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Knapp,S., (2006) J. Immunol. 176 (5), 3189-3195
• Description of Target: LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP).The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found on chromosome 20, immediately downstream of the BPI gene.
• Protein Interactions: TSC22D4; PYCRL; TRA2A; PRDX4; SETD1A; CBFA2T2; BAG6; PSMA3; SMAD3; HSPB1; FTH1; C4BPA; BST1; CAMP; APOA1; RPS21; CD14; CFHR1; IRF6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-LBP (ARP41546_P050) antibody is Catalog # AAP41546 (Previous Catalog # AAPP24232)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LBP
• Uniprot ID: P18428
• Protein Name: Lipopolysaccharide-binding protein
• Publications:

  Seasonal heat load is more potent than the degree of body weight loss in dysregulating immune function by reducing white blood cell populations and increasing inflammation in Holstein dairy cows. J Dairy Sci. 103, 10809-10822 (2020). 32896401

• Protein Accession #: NP_004130
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004139
• Tested Species Reactivity: Human
• Gene Symbol: LBP
• Predicted Species Reactivity: Human, Cow, Horse, Pig
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Horse: 85%; Human: 100%; Pig: 79%
• Image 1: Human liver tissue
  
  Rabbit Anti-LBP Antibody
  Catalog Number: ARP41546_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
  Observed Staining: Cytoplasm and plasma membrane in endothelial cells in sinusoids
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 2: Human HepG2
  
  WB Suggested Anti-LBP Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 3: Human Liver Tissue
  
  LBP antibody - C-terminal region (ARP41546_P050)
  Catalog Number: ARP41546_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
  Observed Staining: Cell membrane in endothelial cell in sinusoids
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 4:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.