Product Number |
ARP39508_T100 |
Product Page |
www.avivasysbio.com/foxa2-antibody-n-terminal-region-arp39508-t100.html |
Name |
FOXA2 Antibody - N-terminal region (ARP39508_T100) |
Protein Size (# AA) |
457 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
3170 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Forkhead box A2 |
Alias Symbols |
HNF3B, TCF3B, HNF-3-beta |
Peptide Sequence |
Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Verschuur,M., (2005) J. Biol. Chem. 280 (17), 16763-16771 |
Description of Target |
FOXA2 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene. |
Protein Interactions |
PPARGC1B; GSC; EN2; OTX2; ONECUT1; NCOA1; TLE1; MIP; HOXA5; LHX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXA2 (ARP39508_T100) antibody |
Blocking Peptide |
For anti-FOXA2 (ARP39508_T100) antibody is Catalog # AAP39508 (Previous Catalog # AAPP21524) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA2 |
Uniprot ID |
Q9Y261 |
Protein Name |
Hepatocyte nuclear factor 3-beta |
Protein Accession # |
NP_710141 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_153675 |
Tested Species Reactivity |
Human |
Gene Symbol |
FOXA2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; |
Image 1 | Human Jurkat
| WB Suggested Anti-FOXA2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|
|