| Product Number |
ARP34698_T100 |
| Product Page |
www.avivasysbio.com/trim3-antibody-n-terminal-region-arp34698-t100.html |
| Name |
TRIM3 Antibody - N-terminal region (ARP34698_T100) |
| Protein Size (# AA) |
744 amino acids |
| Molecular Weight |
81kDa |
| NCBI Gene Id |
10612 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Tripartite motif containing 3 |
| Alias Symbols |
BERP, HAC1, RNF22, RNF97 |
| Peptide Sequence |
Synthetic peptide located within the following region: TICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reymond,A., et al., (2001) EMBO J. 20 (9), 2140-2151 |
| Description of Target |
The protein encoded by TRIM3 is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. |
| Protein Interactions |
CUL3; UBC; HECW2; KIF21B; TNFAIP3; HGS; MYO5A; ACTN4; UBE2D4; UBE2U; UBE2G2; TRIM3; UBE2K; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM3 (ARP34698_T100) antibody |
| Blocking Peptide |
For anti-TRIM3 (ARP34698_T100) antibody is Catalog # AAP34698 (Previous Catalog # AAPP05888) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM3 |
| Uniprot ID |
Q6ZTE7 |
| Protein Name |
cDNA FLJ44731 fis, clone BRACE3025719, highly similar to Homo sapiens ring finger protein 22 (RNF22) EMBL BAC86643.1 |
| Protein Accession # |
NP_006449 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_006458 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 92% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-TRIM3 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
