TRIM3 Antibody - N-terminal region (ARP34698_T100)

Catalog No: ARP34698_T100

WB Suggested Anti-TRIM3 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: TICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHM
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-TRIM3 (ARP34698_T100) antibody is Catalog # AAP34698 (Previous Catalog # AAPP05888)
• Reference: Reymond,A., et al., (2001) EMBO J. 20 (9), 2140-2151

Target Info

• Gene Symbol: TRIM3
• Gene Full Name: Tripartite motif containing 3
• Alias Symbols: BERP, HAC1, RNF22, RNF97
• NCBI Gene Id: 10612
• Protein Name: cDNA FLJ44731 fis, clone BRACE3025719, highly similar to Homo sapiens ring finger protein 22 (RNF22) EMBL BAC86643.1
• Description of Target: The protein encoded by TRIM3 is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport.
• Uniprot ID: Q6ZTE7
• Protein Accession #: NP_006449
• Nucleotide Accession #: NM_006458
• Protein Size (# AA): 744
• Molecular Weight: 81kDa
• Protein Interactions: CUL3; UBC; HECW2; KIF21B; TNFAIP3; HGS; MYO5A; ACTN4; UBE2D4; UBE2U; UBE2G2; TRIM3; UBE2K;