TBX20 Antibody - N-terminal region (ARP33177_P050)

• Product Number: ARP33177_P050
• Name: TBX20 Antibody - N-terminal region (ARP33177_P050)
• Protein Size (# AA): 447 amino acids
• Molecular Weight: 49kDa
• NCBI Gene Id: 57057
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: T-box 20
• Alias Symbols: ASD4
• Peptide Sequence: Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
• Description of Target: TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.
• Protein Interactions: UBC; ZSCAN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  SPR Affinity Characterization
  
• Blocking Peptide: For anti-TBX20 (ARP33177_P050) antibody is Catalog # AAP33177 (Previous Catalog # AAPP04214)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX20
• Uniprot ID: Q9UMR3
• Protein Name: T-box transcription factor TBX20
• Protein Accession #: NP_065150
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020417
• Tested Species Reactivity: Human
• Gene Symbol: TBX20
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human kidney
  
  Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TBX20 antibody (ARP33177_P050)
• Image 2: Human Muscle
  
  Human Muscle
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
• Image 4:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.