CCNL1 Antibody - N-terminal region (ARP33174_T100)

• Product Number: ARP33174_T100
• Name: CCNL1 Antibody - N-terminal region (ARP33174_T100)
• Protein Size (# AA): 526 amino acids
• Molecular Weight: 60 kDa
• NCBI Gene Id: 57018
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cyclin L1
• Alias Symbols: ANIA6A, BM-001, PRO1073, ania-6a
• Peptide Sequence: Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
• Description of Target: CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
• Protein Interactions: TFIP11; APPBP2; SUMO1; UBC; NEDD8; JMJD6; CSNK2A2; APP; ISG15; SRSF2; CDK11A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CCNL1 (ARP33174_T100) antibody is Catalog # AAP33174 (Previous Catalog # AAPP04211)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCNL1
• Uniprot ID: Q8NI48
• Protein Name: Cyclin-L1
• Sample Type Confirmation:

  CCNL1 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_064703
• Purification: Protein A purified
• Nucleotide Accession #: NM_020307
• Tested Species Reactivity: Human
• Gene Symbol: CCNL1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-CCNL1 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysateCCNL1 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 2-3 ug/mL. Also recognizes isoform 2 at ~25 kDa in some samples