| Product Number |
ARP32303_T100 |
| Product Page |
www.avivasysbio.com/foxl1-antibody-n-terminal-region-arp32303-t100.html |
| Name |
FOXL1 Antibody - N-terminal region (ARP32303_T100) |
| Protein Size (# AA) |
345 amino acids |
| Molecular Weight |
36 kDa |
| NCBI Gene Id |
2300 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Forkhead box L1 |
| Alias Symbols |
FKH6, FKHL11, FREAC7 |
| Peptide Sequence |
Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fang,J., et al., (2000) Am. J. Hum. Genet. 67 (6), 1382-1388 |
| Description of Target |
FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins. |
| Protein Interactions |
BMPR2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-FOXL1 (ARP32303_T100) antibody |
| Blocking Peptide |
For anti-FOXL1 (ARP32303_T100) antibody is Catalog # AAP32303 (Previous Catalog # AAPP03286) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXL1 |
| Uniprot ID |
Q12952 |
| Protein Name |
Forkhead box protein L1 |
| Protein Accession # |
NP_005241 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005250 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
FOXL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 92%; Rat: 86% |
| Image 1 | Human Muscle
 | Human Muscle |
| | Image 2 | Human Liver
 | WB Suggested Anti-FOXL1 Antibody Titration: 2.5ug/ml
Positive Control: Human Liver |
| | Image 3 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
|
