MTF1 Antibody - C-terminal region (ARP32027_T100)

• Product Number: ARP32027_T100
• Name: MTF1 Antibody - C-terminal region (ARP32027_T100)
• Protein Size (# AA): 753 amino acids
• Molecular Weight: 81kDa
• NCBI Gene Id: 4520
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Metal-regulatory transcription factor 1
• Alias Symbols: ZRF, MTF-1
• Peptide Sequence: Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chen,X., et al., (2004) J. Biol. Chem. 279 (6), 4515-4522
• Description of Target: The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.
• Protein Interactions: AP1M1; EP300; CREBBP; MT1G;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-MTF1 (ARP32027_T100) antibody is Catalog # AAP32027 (Previous Catalog # AAPP02929)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MTF1
• Uniprot ID: Q14872
• Protein Name: Metal regulatory transcription factor 1
• Sample Type Confirmation:

  MTF1 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_005946
• Purification: Protein A purified
• Nucleotide Accession #: NM_005955
• Tested Species Reactivity: Human
• Gene Symbol: MTF1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.