Sku |
AAP30159 |
Old sku |
AAPS08605 |
Price |
$99.00 |
Name |
Ccna2 Peptide - C-terminal region (AAP30159) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Ccna2 |
Alias symbols |
MGC156527, Ccna2 |
Gene id |
114494 |
Description of target |
The function of Ccna2 remains unknown. |
Protein accession num |
NP_446154 |
Nucleotide accession num |
NM_053702 |
Protein size |
418 amino acids |
Molecular weight |
47kDa |
Species reactivity |
Rat |
Application |
WB, IHC |
Peptide sequence |
TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Ccna2 Antibody (ARP30159_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |