CDK7 Antibody - middle region (P100995_P050)

Data Sheet
 
Product Number P100995_P050
Product Page www.avivasysbio.com/cdk7-antibody-middle-region-p100995-p050.html
Name CDK7 Antibody - middle region (P100995_P050)
Protein Size (# AA) 346 amino acids
Molecular Weight 39kDa
NCBI Gene Id 1022
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cyclin-dependent kinase 7
Description
Alias Symbols CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15
Peptide Sequence Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,Y., (2007) Lung Cancer 58 (2), 171-183
Description of Target CDK7 is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions UBC; RPA3; RPA2; RPA1; GTF2H4; GTF2H3; GTF2H2; GTF2H1; ERCC5; ERCC3; ERCC2; CDK7; CCNH; ATP2B4; A2M; GTF2H5; SRPK2; SRPK1; MNAT1; TP53; CDK2; CTD; MBP; CDK1; CCNB1; CCNA2; Dlg4; UVSSA; HSP90AA1; HSD17B4; HLA-DQA1; SUPT5H; POLR2A; GTF2E2; GTF2E1; CDK9; APP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDK7 (P100995_P050) antibody
Blocking Peptide For anti-CDK7 (P100995_P050) antibody is Catalog # AAP31342 (Previous Catalog # AAPP02093)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDK7
Uniprot ID P50613
Protein Name Cyclin-dependent kinase 7
Protein Accession # NP_001790
Purification Affinity Purified
Nucleotide Accession # NM_001799
Tested Species Reactivity Human
Gene Symbol CDK7
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 80%; Dog: 86%; Guinea Pig: 78%; Horse: 86%; Human: 100%; Pig: 86%; Rat: 86%
Image 1
Human THP-1
WB Suggested Anti-CDK7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com