TAL1 Antibody - middle region (P100970_P050)

Data Sheet
 
Product Number P100970_P050
Product Page www.avivasysbio.com/tal1-antibody-middle-region-p100970-p050.html
Name TAL1 Antibody - middle region (P100970_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6886
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-cell acute lymphocytic leukemia 1
Description
Alias Symbols SCL, TCL5, tal-1, bHLHa17
Peptide Sequence Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ravet,E., et al., (2004) Blood 103 (9), 3326-3335
Description of Target TAL-1 modulates the angiogenic response of endothelial cells by stimulating cell morphogenesis and by influencing their behavior in migration.
Protein Interactions ELSPBP1; SIN3A; KAT2B; EP300; HOXB9; DRG1; CHD3; ZHX1; STUB1; UBC; RB1; SSBP2; SSBP3; RCOR1; KDM1A; LDB1; TCF12; TCF3; RBBP7; LYL1; HDAC2; HDAC1; CHD4; CBFA2T3; RUNX1; SUPT16H; TAL1; CDK9; TRIM33; SUV39H1; SATB1; TRIM27; NCAPG2; MAPK3; SP1; LMO1; LMO2; GA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAL1 (P100970_P050) antibody
Blocking Peptide For anti-TAL1 (P100970_P050) antibody is Catalog # AAP31330 (Previous Catalog # AAPP03107)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TAL1
Uniprot ID P17542
Protein Name T-cell acute lymphocytic leukemia protein 1
Protein Accession # NP_003180
Purification Affinity Purified
Nucleotide Accession # NM_003189
Tested Species Reactivity Human, Mouse
Gene Symbol TAL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Image 1
Mouse Kidney
Host: Mouse
Target Name: TAL1
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
Image 2
Human HepG2
WB Suggested Anti-TAL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 3
Human Spleen
Human Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com