RBL1 Antibody - N-terminal region (P100682_P050)

Data Sheet
 
Product Number P100682_P050
Product Page www.avivasysbio.com/rbl1-antibody-n-terminal-region-p100682-p050.html
Name RBL1 Antibody - N-terminal region (P100682_P050)
Protein Size (# AA) 1014 amino acids
Molecular Weight 115kDa
NCBI Gene Id 5933
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Retinoblastoma-like 1 (p107)
Alias Symbols PRB1, p107, CP107
Peptide Sequence Synthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ross,A.S., (2008) Biochem. Biophys. Res. Commun. 366 (4), 927-931
Description of Target RBL1 is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions DYRK1B; DYRK1A; CDK2; MAGEA11; E2F1; AR; UBC; RBBP8; E2F4; PLSCR1; NUCB1; LAMB2; NR4A1; GOLGA2; FN1; EPHA2; CDK6; CDK4; AOX1; SP1; SNRPD3; DGKZ; ID2; RINT1; E2F3; E2F2; PPP1CA; TOP1; SMARCA4; CCNA2; LIN9; LIN54; LIN37; MYBL2; MAPK6; IRF3; RBL2; DHX30; NR2
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBL1 (P100682_P050) antibody
Blocking Peptide For anti-RBL1 (P100682_P050) antibody is Catalog # AAP31024 (Previous Catalog # AAPP01757)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RBL1
Uniprot ID P28749-2
Protein Name Retinoblastoma-like protein 1
Protein Accession # NP_899662
Purification Affinity Purified
Nucleotide Accession # NM_183404
Tested Species Reactivity Human, Mouse
Gene Symbol RBL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 85%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 92%
Image 1
Human COLO205
WB Suggested Anti-RBL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
Image 2
Mouse Pancreas
Host: Mouse
Target Name: RBL1
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com