| Product Number |
P100623_P050 |
| Product Page |
www.avivasysbio.com/tal2-antibody-middle-region-p100623-p050.html |
| Name |
TAL2 Antibody - middle region (P100623_P050) |
| Protein Size (# AA) |
108 amino acids |
| Molecular Weight |
12kDa |
| NCBI Gene Id |
6887 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
T-cell acute lymphocytic leukemia 2 |
| Description |
|
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: LGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Humphray,S.J., (2004) Nature 429 (6990), 369-374 |
| Description of Target |
TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. |
| Protein Interactions |
TCF4; PCBD2; CBFA2T2; TCF12; RUNX1T1; MAPK3; LMO1; LMO2; TCF3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TAL2 (P100623_P050) antibody |
| Blocking Peptide |
For anti-TAL2 (P100623_P050) antibody is Catalog # AAP30963 (Previous Catalog # AAPP01687) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TAL2 |
| Uniprot ID |
Q16559 |
| Protein Name |
T-cell acute lymphocytic leukemia protein 2 |
| Protein Accession # |
NP_005412 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005421 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TAL2 |
| Predicted Species Reactivity |
Human, Cow |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 78%; Human: 100% |
| Image 1 | Human Spleen
 | WB Suggested Anti-TAL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen |
|
|
