| Product Number |
OPCA04657 |
| Product Page |
www.avivasysbio.com/nsp4-recombinant-protein-chikv-opca04657.html |
| Name |
NSP4 Recombinant Protein (CHIKV) (OPCA04657) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
31.1 kDa |
| Tag |
N-terminal 6xHis-tagged |
| NCBI Gene Id |
956309 |
| Purity |
Greater than 85% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
nonstructural polyprotein |
| Protein Range |
2228-2474 aa |
| Alias Symbols |
CHIKVgp1;nonstructural polyprotein;Polyprotein nsP1234. |
| Peptide Sequence |
DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Complete nucleotide sequence of chikungunya virus and evidence for an internal polyadenylation site.Khan A.H., Morita K., Parquet Md Mdel C., Hasebe F., Mathenge E.G., Igarashi A.J. Gen. Virol. 83:3075-3084(2002) |
| Description of Target |
P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK |
| Datasheets/Manuals |
Printable datasheet for NSP4 Recombinant Protein (CHIKV) (OPCA04657) (OPCA04657) |
| Additional Information |
Species Specificity Detail: Chikungunya virus (strain S27-African prototype) (CHIKV) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q8JUX6 |
| Protein Name |
Non-structural polyprotein |
| Gene Symbol |
CHIKVgp1 |
| Predicted Species Reactivity |
Chikungunya virus|Chikungunya Virus |
| Image 1 | |
|
