| Product Number |
OPCA04032 |
| Product Page |
www.avivasysbio.com/aasdhppt-recombinant-protein-human-opca04032.html |
| Name |
AASDHPPT Recombinant Protein (Human) (OPCA04032) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
51.8 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| NCBI Gene Id |
60496 |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase |
| Protein Range |
1-309 aa |
| Alias Symbols |
4'-phosphopantetheinyl transferase;AASD-PPT;ACPS;alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase;CGI-80;holo ACP synthase;holo-[acyl-carrier-protein] synthase;L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase;LYS2;LYS5;LYS5 ortholog. |
| Peptide Sequence |
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Identification of the alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase gene, the human ortholog of the yeast LYS5 gene.Praphanphoj V., Sacksteder K.A., Gould S.J., Thomas G.H., Geraghty M.T.Mol. Genet. Metab. 72:336-342(2001) |
| Description of Target |
Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
| Datasheets/Manuals |
Printable datasheet for AASDHPPT Recombinant Protein (Human) (OPCA04032) (OPCA04032) |
| Additional Information |
Species Specificity Detail: Homo sapiens (Human) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q9NRN7 |
| Protein Name |
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase |
| Protein Accession # |
NP_056238 |
| Nucleotide Accession # |
NM_015423 |
| Gene Symbol |
AASDHPPT |
| Predicted Species Reactivity |
Homo sapiens|Human |
| Image 1 | |
|
