| Product Number |
OPCA03131 |
| Product Page |
www.avivasysbio.com/triticum-aestivum-recombinant-protein-wheat-opca03131.html |
| Name |
Triticum aestivum Recombinant Protein (Wheat) (OPCA03131) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
48.5 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| Host |
Triticum aestivum |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
24-307 aa |
| Alias Symbols |
Glutenin, low molecular weight subunit 1D1 |
| Peptide Sequence |
RCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Molecular characterization of an active wheat LMW glutenin gene and its relation to other wheat and barley prolamin genes.Colot V., Bartels D., Thompson R., Flavell R.Mol. Gen. Genet. 216:81-90(1989) |
| Description of Target |
Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
RCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY |
| Datasheets/Manuals |
Printable datasheet for Triticum aestivum Recombinant Protein (Wheat) (OPCA03131) (OPCA03131) |
| Additional Information |
Relevance: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough. |
| Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P10386 |
| Protein Name |
Glutenin, low molecular weight subunit 1D1 |
| Predicted Species Reactivity |
Triticum aestivum|Wheat |
| Image 1 | Protein SDS-PAGE
 | Triticum aestivum Recombinant Protein (Triticum aestivum) (OPCA03131) in SDS-PAGE showing the molecular weight of approximately 48.5 kDa. |
|
