| Product Number |
OPCA02962 |
| Product Page |
www.avivasysbio.com/2-5-recombinant-protein-bacteriophage-t7-opca02962.html |
| Name |
2.5 Recombinant Protein (Bacteriophage T7) (OPCA02962) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
25.7 kDa |
| Tag |
Tag-Free |
| NCBI Gene Id |
1261080 |
| Host |
Enterobacteria phage T8 |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
Yeast |
| Gene Full Name |
single-stranded DNA-binding protein |
| Alias Symbols |
single-stranded DNA-binding protein;T7p17. |
| Peptide Sequence |
MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Essential residues in the C terminus of the bacteriophage T7 gene 2.5 single-stranded DNA-binding protein.Marintcheva B., Hamdan S.M., Lee S.J., Richardson C.C.J. Biol. Chem. 281:25831-25840(2006) |
| Description of Target |
Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
Full Length: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF |
| Datasheets/Manuals |
Printable datasheet for 2.5 Recombinant Protein (Bacteriophage T7) (OPCA02962) (OPCA02962) |
| Uniprot ID |
P03696 |
| Protein Name |
Single-stranded DNA-binding protein gp2.5 |
| Protein Accession # |
NP_041970.1
|
| Purification |
Affinity purified using AC |
| Nucleotide Accession # |
NC_001604.1 |
| Gene Symbol |
T7p17 |
| Predicted Species Reactivity |
Enterobacteria phage T7|Erischia phage T7 |
| Image 1 | Protein SDS-PAGE
 | Single-stranded DNA-binding protein gp2.5, Recombinant (Enterobacteria phage T8) (OPCA02962) in SDS-PAGE showing the molecular weight of approximately 27.7 kDa. |
|
|
