| Product Number |
OPCA00038 |
| Product Page |
www.avivasysbio.com/ccl20-recombinant-protein-rhesus-macaque-opca00038.html |
| Name |
CCL20 Recombinant Protein (Rhesus macaque) (OPCA00038) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
36.6 kDa |
| Tag |
N-terminal 10xHis-GST-tagged |
| NCBI Gene Id |
574182 |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
C-C motif chemokine ligand 20 |
| Protein Range |
27-96 aa |
| Alias Symbols |
C-C motif chemokine 20;chemokine CCL20/MIP-3ALPHA. |
| Peptide Sequence |
ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines.Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A.Cytokine 18:140-148(2002) |
| Description of Target |
Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM |
| Datasheets/Manuals |
Printable datasheet for CCL20 Recombinant Protein (Rhesus macaque) (OPCA00038) (OPCA00038) |
| Additional Information |
Tag information : GST tag
|
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q8HYP6 |
| Protein Name |
C-C motif chemokine |
| Gene Symbol |
CCL20 |
| Predicted Species Reactivity |
Macaca mulatta|Rhesus Monkey |
| Image 1 | |
|
