| Product Number |
OAAL00602 |
| Product Page |
www.avivasysbio.com/hey1-antibody-oaal00602.html |
| Name |
HEY1 Antibody (OAAL00602) |
| Clone |
1B9 |
| Isotype |
IgG2a Kappa |
| NCBI Gene Id |
23462 |
| Host |
Mouse |
| Clonality |
Monoclonal |
| Gene Full Name |
hes related family bHLH transcription factor with YRPW motif 1 |
| Alias Symbols |
basic helix-loop-helix protein OAF1;BHLHb31;cardiovascular helix-loop-helix factor 2;CHF2;class B basic helix-loop-helix protein 31;hairy and enhancer of split-related protein 1;hairy/enhancer-of-split related with YRPW motif 1;hairy/enhancer-of-split related with YRPW motif protein 1;hairy-related transcription factor 1;HERP2;HESR1;HES-related repressor protein 1;HES-related repressor protein 2;hHRT1;HRT-1;NERP2;OAF1. |
| Peptide Sequence |
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG |
| Product Format |
Liquid |
| Description of Target |
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
| Reconstitution and Storage |
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Datasheets/Manuals |
Printable datasheet for HEY1 Antibody (OAAL00602) |
| Immunogen |
HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Formulation |
In 1x PBS, pH 7.4 |
| Protein Name |
hairy/enhancer-of-split related with YRPW motif protein 1 isoform a [Homo sapiens]|Homo sapiens hes related family bHLH transcription factor with YRPW motif 1 (HEY1), transcript variant 1, mRNA |
| Protein Accession # |
https://www.ncbi.nlm.nih.gov/protein/NP_036390 |
| Nucleotide Accession # |
https://www.ncbi.nlm.nih.gov/nuccore/NM_012258 |
| Gene Symbol |
HEY1 |
| Predicted Species Reactivity |
Human, Mouse |
| Application |
Enzyme-linked immunosorbent assay|Western blot |
| Image 1 | Recombinant GST tagged HEY1
 | Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody. |
| | Image 2 | Transfected 293T cell line
 | Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M03), clone 1B9.
Lane 1: HEY1 transfected lysate(32.613 KDa).
Lane 2: Non-transfected lysate.
|
|
|
