Product Number |
AVARP13104_T100 |
Product Page |
www.avivasysbio.com/trhr-antibody-middle-region-avarp13104-t100.html |
Name |
TRHR Antibody - middle region (AVARP13104_T100) |
Protein Size (# AA) |
398 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
7201 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Thyrotropin-releasing hormone receptor |
Alias Symbols |
CHNG7, TRH-R |
Peptide Sequence |
Synthetic peptide located within the following region: ISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Iwasaki, T., et al., (1996). J. Biol. Chem. 271 (36), 22183-22188. |
Description of Target |
TRHR is a receptor for thyrotropin-releasing hormone. This receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. |
Protein Interactions |
TRHR; TRH; ARRB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TRHR (AVARP13104_T100) antibody |
Blocking Peptide |
For anti-TRHR (AVARP13104_T100) antibody is Catalog # AAP30770 (Previous Catalog # AAPP01433) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TRHR |
Uniprot ID |
P34981 |
Protein Name |
Thyrotropin-releasing hormone receptor |
Protein Accession # |
NP_003292 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003301 |
Gene Symbol |
TRHR |
Predicted Species Reactivity |
Mouse, Rat, Dog, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: TRHR Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 1ug/ml |
|
|