HTR1A Antibody - N-terminal region (AVARP13041_T100)

Data Sheet
 
Product Number AVARP13041_T100
Product Page www.avivasysbio.com/htr1a-antibody-n-terminal-region-avarp13041-t100.html
Name HTR1A Antibody - N-terminal region (AVARP13041_T100)
Protein Size (# AA) 422 amino acids
Molecular Weight 46kDa
NCBI Gene Id 3350
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Alias Symbols G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1
Peptide Sequence Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lopez-Figueroa,A.L., et al., (2004) Biol. Psychiatry 55 (3), 225-233.
Description of Target This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Protein Interactions UBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HTR1A (AVARP13041_T100) antibody
Blocking Peptide For anti-HTR1A (AVARP13041_T100) antibody is Catalog # AAP30710 (Previous Catalog # AAPP01367)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
Uniprot ID P08908
Protein Name 5-hydroxytryptamine receptor 1A
Protein Accession # NP_000515
Purification Protein A purified
Nucleotide Accession # NM_000524
Tested Species Reactivity Human
Gene Symbol HTR1A
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-HTR1A Antibody Titration: 0.0625ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com