HTR1A Antibody - N-terminal region (AVARP13041_T100)

• Product Number: AVARP13041_T100
• Name: HTR1A Antibody - N-terminal region (AVARP13041_T100)
• Protein Size (# AA): 422 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 3350
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
• Alias Symbols: G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1
• Peptide Sequence: Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lopez-Figueroa,A.L., et al., (2004) Biol. Psychiatry 55 (3), 225-233.
• Description of Target: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
• Protein Interactions: UBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HTR1A (AVARP13041_T100) antibody is Catalog # AAP30710 (Previous Catalog # AAPP01367)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
• Uniprot ID: P08908
• Protein Name: 5-hydroxytryptamine receptor 1A
• Protein Accession #: NP_000515
• Purification: Protein A purified
• Nucleotide Accession #: NM_000524
• Tested Species Reactivity: Human
• Gene Symbol: HTR1A
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-HTR1A Antibody Titration: 0.0625ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate