HTR1A Antibody - N-terminal region : Biotin (AVARP13041_P050-Biotin)

• Product Number: AVARP13041_P050-Biotin
• Name: HTR1A Antibody - N-terminal region : Biotin (AVARP13041_P050-Biotin)
• Protein Size (# AA): 422 amino acids
• Molecular Weight: 46kDa
• Conjugation: Biotin
• NCBI Gene Id: 3350
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
• Alias Symbols: G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1
• Peptide Sequence: Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Czesak,M., (2006) J. Neurosci. 26 (6), 1864-1871
• Description of Target: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
• Protein Interactions: UBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-HTR1A (AVARP13041_P050-Biotin) antibody is Catalog # AAP30710
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
• Uniprot ID: P08908
• Protein Name: 5-hydroxytryptamine receptor 1A
• Publications:

  Szewczyk, B. et al. Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder. Int. J. Neuropsychopharmacol. 12, 155-68 (2009). WB, Human 18561871

  Cordeaux, Y., Pasupathy, D., Bacon, J., Charnock-Jones, D. S. & Smith, G. C. S. Characterization of serotonin receptors in pregnant human myometrium. J. Pharmacol. Exp. Ther. 328, 682-91 (2009). WB, Human 19075042

  Iyo, A. H. et al. Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress. Neuroscience 163, 1119-27 (2009). WB, Human 19647046

  Szewczyk, B. et al. Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression. Int. J. Neuropsychopharmacol. 13, 1089-101 (2010). WB, Human 20392296

  Adeosun, S. O., Albert, P. R., Austin, M. C. & Iyo, A. H. 17?-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells. Cell. Mol. Neurobiol. 32, 517-21 (2012). WB, Human 22328058

• Protein Accession #: NP_000515
• Nucleotide Accession #: NM_000524
• Gene Symbol: HTR1A
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: