GAL Antibody - middle region (AVARP13036_P050)

• Product Number: AVARP13036_P050
• Name: GAL Antibody - middle region (AVARP13036_P050)
• Protein Size (# AA): 123 amino acids
• Molecular Weight: 13kDa
• NCBI Gene Id: 51083
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Galanin prepropeptide
• Alias Symbols: ETL8, GALN, GLNN, GMAP, GAL-GMAP
• Peptide Sequence: Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Levran,O., (er) Genes Brain Behav. (2008) In press
• Description of Target: Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions.
• Protein Interactions: SGTA; ELAVL1; GPR151; GALR2; GALR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: Catalog # AAP30699 (Previous Catalog # AAPP01356)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAL
• Uniprot ID: P22466
• Protein Name: Galanin peptides
• Sample Type Confirmation:

  GAL is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_057057
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015973
• Tested Species Reactivity: Human
• Gene Symbol: GAL
• Predicted Species Reactivity: Human, Dog
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 76%; Human: 100%
• Image 1: Human HEK293T
  
  WB Suggested Anti-GAL Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293TGAL is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells