GLRA1 Antibody - middle region (AVARP13003_P050)

Data Sheet
 
Product Number AVARP13003_P050
Product Page www.avivasysbio.com/glra1-antibody-middle-region-avarp13003-p050.html
Name GLRA1 Antibody - middle region (AVARP13003_P050)
Protein Size (# AA) 449 amino acids
Molecular Weight 51kDa
Subunit alpha-1
NCBI Gene Id 2741
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glycine receptor, alpha 1
Alias Symbols STHE, HKPX1
Peptide Sequence Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Schofield,C.M., et al., (2004) Biochemistry 43 (31), 10058-10063
Description of Target The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GLRA1 (AVARP13003_P050) antibody
Blocking Peptide For anti-GLRA1 (AVARP13003_P050) antibody is Catalog # AAP30751 (Previous Catalog # AAPP01412)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GLRA1
Uniprot ID P23415
Protein Name Glycine receptor subunit alpha-1
Sample Type Confirmation

GLRA1 is supported by BioGPS gene expression data to be expressed in Raji

Protein Accession # NP_000162
Purification Affinity Purified
Nucleotide Accession # NM_000171
Tested Species Reactivity Human
Gene Symbol GLRA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Raji
WB Suggested Anti-GLRA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji cell lysateGLRA1 is supported by BioGPS gene expression data to be expressed in Raji
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com