Product Number |
AVARP13003_P050 |
Product Page |
www.avivasysbio.com/glra1-antibody-middle-region-avarp13003-p050.html |
Name |
GLRA1 Antibody - middle region (AVARP13003_P050) |
Protein Size (# AA) |
449 amino acids |
Molecular Weight |
51kDa |
Subunit |
alpha-1 |
NCBI Gene Id |
2741 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glycine receptor, alpha 1 |
Alias Symbols |
STHE, HKPX1 |
Peptide Sequence |
Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Schofield,C.M., et al., (2004) Biochemistry 43 (31), 10058-10063 |
Description of Target |
The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GLRA1 (AVARP13003_P050) antibody |
Blocking Peptide |
For anti-GLRA1 (AVARP13003_P050) antibody is Catalog # AAP30751 (Previous Catalog # AAPP01412) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GLRA1 |
Uniprot ID |
P23415 |
Protein Name |
Glycine receptor subunit alpha-1 |
Sample Type Confirmation |
GLRA1 is supported by BioGPS gene expression data to be expressed in Raji |
Protein Accession # |
NP_000162 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000171 |
Tested Species Reactivity |
Human |
Gene Symbol |
GLRA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Raji
| WB Suggested Anti-GLRA1 Antibody Titration: 0.2-1 ug/ml Positive Control: Raji cell lysateGLRA1 is supported by BioGPS gene expression data to be expressed in Raji |
|
|