PDE1B Antibody - middle region (AVARP09056_P050)

• Product Number: AVARP09056_P050
• Name: PDE1B Antibody - middle region (AVARP09056_P050)
• Protein Size (# AA): 536 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 5153
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Phosphodiesterase 1B, calmodulin-dependent
• Alias Symbols: PDE1B1, PDES1B, HEL-S-79p
• Peptide Sequence: Synthetic peptide located within the following region: VKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bender,A.T. (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (2), 460-465
• Description of Target: PDE1B has a preference for cGMP as a substrate.
• Protein Interactions: POT1; UBE3A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PDE1B (AVARP09056_P050) antibody is Catalog # AAP30597 (Previous Catalog # AAPP01249)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE1B
• Uniprot ID: Q01064
• Protein Name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
• Protein Accession #: NP_000915
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000924
• Tested Species Reactivity: Human
• Gene Symbol: PDE1B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 93%
• Image 1: Human HT1080
  
  WB Suggested Anti-PDE1B Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:2500
  Positive Control: HT1080 cell lysate