OLFR139 Antibody - C-terminal region (ARP96627_P050)

Data Sheet
 
Product Number ARP96627_P050
Product Page www.avivasysbio.com/olfr139-antibody-c-terminal-region-arp96627-p050.html
Product Name OLFR139 Antibody - C-terminal region (ARP96627_P050)
Size 100 ul
Gene Symbol OLFR139
Alias Symbols M5, MOR255-2
Protein Size (# AA) 315 amino acids
Molecular Weight 34 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 259005
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name olfactory receptor 139
Peptide Sequence Synthetic peptide located within the following region: LGSVSASDKDKGIGILNTILSPMLNPLIYSLRNPDVQGALKRVLTGKRYP
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-OLFR139 (ARP96627_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-OLFR139 (ARP96627_P050) antibody is Catalog # ARP96627_P050
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR139
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OLFR139.
Swissprot Id Q60891
Protein Name Olfactory receptor 139
Protein Accession # NP_667214.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OLFR139.
Nucleotide Accession # NM_147003.1
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Lung
Host: Rabbit
Target Name: OLFR139
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com