Product Number |
ARP88208_P050 |
Product Page |
www.avivasysbio.com/gnl3-antibody-c-terminal-region-arp88208-p050.html |
Name |
GNL3 Antibody - C-terminal region (ARP88208_P050) |
Protein Size (# AA) |
549 amino acids |
Molecular Weight |
60 kDa |
NCBI Gene Id |
26354 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
guanine nucleotide binding protein-like 3 (nucleolar) |
Alias Symbols |
NS, E2IG3, NNP47, C77032 |
Peptide Sequence |
Synthetic peptide located within the following region: ELPKRKERKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants encoding two different isoforms have been found for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GNL3 (ARP88208_P050) antibody |
Blocking Peptide |
For anti-GNL3 (ARP88208_P050) antibody is Catalog # AAP88208 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GNL3 |
Uniprot ID |
Q9BVP2 |
Protein Name |
guanine nucleotide-binding protein-like 3 |
Protein Accession # |
NP_055181.3 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_014366.4 |
Tested Species Reactivity |
Human |
Gene Symbol |
GNL3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: GNL3 Sample Tissue: Human 786-0 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|