| Product Number |
ARP86323_P050 |
| Product Page |
www.avivasysbio.com/c17orf75-antibody-n-terminal-region-arp86323-p050.html |
| Name |
C17ORF75 Antibody - N-terminal region (ARP86323_P050) |
| Protein Size (# AA) |
396 amino acids |
| Molecular Weight |
45 kDa |
| NCBI Gene Id |
64149 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
chromosome 17 open reading frame 75 |
| Alias Symbols |
SRI2, NJMU-R1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SLQESMDGDEKELESSEEGGSAEERRLEPPSSSHYCLYSYRGSRLAQQRG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
May have a role in spermatogenesis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C17ORF75 (ARP86323_P050) antibody |
| Blocking Peptide |
For anti-C17ORF75 (ARP86323_P050) antibody is Catalog # AAP86323 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C17ORF75 |
| Uniprot ID |
Q9HAS0 |
| Protein Name |
protein Njmu-R1 |
| Protein Accession # |
NP_071739.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_022344.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C17ORF75 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HT1080 Whole Cell
 | Host: Rabbit
Target Name: C17ORF75
Sample Tissue: Human HT1080 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
