Product Number |
ARP80228_P050 |
Product Page |
www.avivasysbio.com/s100a4-antibody-middle-region-arp80228-p050.html |
Name |
S100A4 Antibody - middle region (ARP80228_P050) |
Protein Size (# AA) |
136 amino acids |
Molecular Weight |
15 kDa |
NCBI Gene Id |
23557 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SNAP associated protein |
Alias Symbols |
BLOS7, BORCS3, SNAPAP, BLOC1S7 |
Peptide Sequence |
Synthetic peptide located within the following region: NARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SNAPIN (ARP80228_P050) antibody |
Blocking Peptide |
For anti-SNAPIN (ARP80228_P050) antibody is Catalog # AAP80228 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SNAPIN |
Uniprot ID |
O95295 |
Protein Name |
SNARE-associated protein Snapin |
Protein Accession # |
NP_036569.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_012437.5 |
Tested Species Reactivity |
Human |
Gene Symbol |
SNAPIN |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human PC-3 Whole Cell
| Host: Rabbit Target Name: SNAPIN Sample Tissue: Human PC-3 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|