CYP19A1 Antibody - middle region (ARP79029_P050)

• Product Number: ARP79029_P050
• Name: CYP19A1 Antibody - middle region (ARP79029_P050)
• Protein Size (# AA): 503 amino acids
• Molecular Weight: 55 kDa
• NCBI Gene Id: 1588
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: cytochrome P450 family 19 subfamily A member 1
• Alias Symbols: ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
• Peptide Sequence: Synthetic peptide located within the following region: VMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative splicing results in multiple transcript variants.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CYP19A1 (ARP79029_P050) antibody is Catalog # AAP79029
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP19A1
• Uniprot ID: P11511
• Protein Name: aromatase
• Protein Accession #: NP_000094.2
• Purification: Affinity purified
• Tested Species Reactivity: Human
• Gene Symbol: CYP19A1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: CYP19A1
  Sample Tissue: Human MCF7 Whole Cell lysates
  Antibody Dilution: 1ug/ml