SPHK2 Antibody - N-terminal region : FITC (ARP74259_P050-FITC)

• Product Number: ARP74259_P050-FITC
• Name: SPHK2 Antibody - N-terminal region : FITC (ARP74259_P050-FITC)
• Protein Size (# AA): 761 amino acids
• Molecular Weight: 83kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 56848
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: SK 2, SK-2, SPK 2, SPK-2
• Peptide Sequence: Synthetic peptide located within the following region: STAPAPPCPCHGVLNSHPFSPPFPQRPDQELTGSWGHGPRSTLVRAKAMA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: This gene encodes one of two sphingosine kinase isozymes that catalyze the phosphorylation of sphingosine into sphingosine 1-phosphate. Sphingosine 1-phosphate mediates many cellular processes including migration, proliferation and apoptosis, and also plays a role in several types of cancer by promoting angiogenesis and tumorigenesis. The encoded protein may play a role in breast cancer proliferation and chemoresistance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Protein Interactions: HECW2; HIST1H3A; LYN; FYN;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-SPHK2 (ARP74259_P050-FITC) antibody is Catalog # AAP74259
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPHK2
• Uniprot ID: Q9NRA0-5
• Purification: Affinity purified
• Gene Symbol: SPHK2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: