CNOT10 Antibody - C-terminal region : FITC (ARP70040_P050-FITC)

Data Sheet
 
Product Number ARP70040_P050-FITC
Product Page www.avivasysbio.com/cnot10-antibody-c-terminal-region-fitc-arp70040-p050-fitc.html
Name CNOT10 Antibody - C-terminal region : FITC (ARP70040_P050-FITC)
Protein Size (# AA) 717 amino acids
Molecular Weight 79kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 25904
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Peptide Sequence Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The function of this protein remains unknown.
Protein Interactions RNF219; HECW2; PPP6R1; LYN; CNOT6L; CNOT6; UBC; VCP; EPAS1; CHMP1B; Cnot3; USP22; CNOT8;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CNOT10 (ARP70040_P050-FITC) antibody
Blocking Peptide For anti-CNOT10 (ARP70040_P050-FITC) antibody is Catalog # AAP70040
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CNOT10
Uniprot ID Q9H9A5-3
Protein Name CCR4-NOT transcription complex subunit 10
Purification Affinity Purified
Gene Symbol CNOT10
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com