C7orf26 Antibody - N-terminal region (ARP68845_P050)

• Product Number: ARP68845_P050
• Name: C7orf26 Antibody - N-terminal region (ARP68845_P050)
• Protein Size (# AA): 352 amino acids
• Molecular Weight: 38kDa
• NCBI Gene Id: 79034
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: KRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of this protein remains unknown.
• Protein Interactions: HDGF; INTS5; INTS3; INTS6; INTS1; AK5;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-C7orf26 (ARP68845_P050) antibody is Catalog # AAP68845
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C7orf26
• Uniprot ID: Q96N11-2
• Protein Name: Uncharacterized protein C7orf26
• Protein Accession #: NP_076972
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024067
• Tested Species Reactivity: Human
• Gene Symbol: C7orf26
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
• Image 1: Human THP-1
  
  Host: Rabbit
  Target Name: C7orf26
  Sample Type: THP-1 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml
• Image 2: MCF7 Cell Lysate, HepG2 Cell Lysate
  
  Host: Rabbit
  Target: C7ORF26
  Positive control (+): MCF7 Cell Lysate (N10)
  Negative control (-): HepG2 Cell Lysate (HG)
  Antibody concentration: 1ug/ml