| Product Number |
ARP68792_P050 |
| Product Page |
www.avivasysbio.com/ankrd62-antibody-c-terminal-region-arp68792-p050.html |
| Name |
ANKRD62 Antibody - C-terminal region (ARP68792_P050) |
| Protein Size (# AA) |
639 amino acids |
| Molecular Weight |
70kDa |
| NCBI Gene Id |
342850 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
DKFZp779B1634 |
| Peptide Sequence |
Synthetic peptide located within the following region: NKGLMKECTLLKERQCQYEKEKEEREVVRRQLQREVDDALNKQLLLEAML |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ANKRD62 (ARP68792_P050) antibody |
| Blocking Peptide |
For anti-ANKRD62 (ARP68792_P050) antibody is Catalog # AAP68792 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD62 |
| Uniprot ID |
A6NC57-2 |
| Protein Name |
Ankyrin repeat domain-containing protein 62 |
| Protein Accession # |
XP_003960794 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ANKRD62 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Guinea Pig: 87%; Human: 100%; Mouse: 91%; Rat: 80%; Yeast: 100% |
| Image 1 | Human Fetal Heart
 | Host: Rabbit
Target Name: ANKRD62
Sample Type: Fetal Heart lysates
Antibody Dilution: 1.0ug/ml |
|
|
