| Product Number |
ARP68165_P050 |
| Product Page |
www.avivasysbio.com/cars2-antibody-n-terminal-region-arp68165-p050.html |
| Name |
CARS2 Antibody - N-terminal region (ARP68165_P050) |
| Protein Size (# AA) |
564 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
79587 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Description |
|
| Alias Symbols |
cysRS, COXPD27 |
| Peptide Sequence |
Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
UBC; NEDD8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CARS2 (ARP68165_P050) antibody |
| Blocking Peptide |
For anti-CARS2 (ARP68165_P050) antibody is Catalog # AAP68165 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARS2 |
| Uniprot ID |
Q9HA77 |
| Protein Name |
Probable cysteine--tRNA ligase, mitochondrial |
| Publications |
Synthesis of Reactive Sulfur Species in Cultured Vascular Endothelial Cells after Exposure to TGF-β1: Induction of Cystathionine γ-Lyase and Cystathionine β-Synthase Expression Mediated by the ALK5-Smad2/3/4 and ALK5-Smad2/3-ATF4 Pathways. Int J Mol Sci. 22 (2021). 34769192 |
| Protein Accession # |
NP_078813 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024537 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CARS2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 85% |
| Image 1 | Human HepG2
 | Host: Rabbit
Target Name: CARS2
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | HeLa Cell Lysate, Human Liver
 | Host: Rabbit
Target: CARS2
Positive control (+): HeLa Cell Lysate (HL)
Negative control (-): Human Liver (LI)
Antibody concentration: 1ug/ml |
|
