SGTB Antibody - N-terminal region : FITC (ARP66945_P050-FITC)

Data Sheet
 
Product Number ARP66945_P050-FITC
Product Page www.avivasysbio.com/sgtb-antibody-n-terminal-region-fitc-arp66945-p050-fitc.html
Name SGTB Antibody - N-terminal region : FITC (ARP66945_P050-FITC)
Protein Size (# AA) 304 amino acids
Molecular Weight 33kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 54557
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols SGT2
Peptide Sequence Synthetic peptide located within the following region: FCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target SGTB is a co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.
Protein Interactions TXNDC12; EFEMP2; RAI2; SERPINE1; IL6ST; LAMP3; UBC; TMPO;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SGTB (ARP66945_P050-FITC) antibody
Blocking Peptide For anti-SGTB (ARP66945_P050-FITC) antibody is Catalog # AAP66945
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SGTB
Uniprot ID Q96EQ0
Protein Accession # XP_005248605
Purification Affinity Purified
Gene Symbol SGTB
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com