| Product Number |
ARP62162_P050 |
| Product Page |
www.avivasysbio.com/atpaf2-antibody-middle-region-arp62162-p050.html |
| Name |
Atpaf2 Antibody - middle region (ARP62162_P050) |
| Protein Size (# AA) |
298 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
303190 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATP synthase mitochondrial F1 complex assembly factor 2 |
| Description |
|
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: TEWDSQQDTIKFYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTIC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Atpaf2 (ARP62162_P050) antibody |
| Blocking Peptide |
For anti-Atpaf2 (ARP62162_P050) antibody is Catalog # AAP62162 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Rat Atpaf2 |
| Uniprot ID |
D3ZTW7 |
| Protein Name |
ATP synthase mitochondrial F1 complex assembly factor 2 (Predicted), isoform CRA_c EMBL EDM04646.1 |
| Publications |
Differential Abundance of Brain Mitochondrial Proteins in Yak and Cattle: A Proteomics-Based Study. Front Vet Sci. 8, 663031 (2021) |
| Protein Accession # |
NP_001100476 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001107006 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Atpaf2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Rat Lung
 | Host: Rabbit
Target Name: Atpaf2
Sample Type: Rat Lung lysates
Antibody Dilution: 1.0ug/ml |
|
|
