UTP4 Antibody - middle region (ARP60682_P050)

Data Sheet
 
Product Number ARP60682_P050
Product Page www.avivasysbio.com/utp4-antibody-middle-region-arp60682-p050.html
Name UTP4 Antibody - middle region (ARP60682_P050)
Protein Size (# AA) 571 amino acids
Molecular Weight 62kDa
NCBI Gene Id 84916
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name UTP4, small subunit processome component
Alias Symbols NAIC, CIRH1A, CIRHIN, TEX292
Peptide Sequence Synthetic peptide located within the following region: ADVQSIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a WD40-repeat-containing protein that is localized to the nucleolus. Mutation of this gene causes North American Indian childhood cirrhosis, a severe intrahepatic cholestasis that results in transient neonatal jaundice, and progresses to periportal fibrosis and cirrhosis in childhood and adolescence. Alternative splicing results in multiple transcript variants.
Protein Interactions UBC; SUMO1; NEDD8; RNF2; HDAC11; UTP15; GLTSCR2; APP; UBD; PRNP; ISG15; SIRT7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UTP4 (ARP60682_P050) antibody
Blocking Peptide For anti-UTP4 (ARP60682_P050) antibody is Catalog # AAP60682
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CIRH1A
Uniprot ID Q969X6-2
Protein Name U3 small nucleolar RNA-associated protein 4 homolog
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol UTP4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Image 1
Human 721_B
Host: Rabbit
Target Name: CIRH1A
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com