FGFBP2 Antibody - C-terminal region (ARP60593_P050)

• Product Number: ARP60593_P050
• Name: FGFBP2 Antibody - C-terminal region (ARP60593_P050)
• Protein Size (# AA): 223 amino acids
• Molecular Weight: 24kDa
• NCBI Gene Id: 83888
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Fibroblast growth factor binding protein 2
• Alias Symbols: KSP37, HBP17RP
• Peptide Sequence: Synthetic peptide located within the following region: LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: FGFBP2 is a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
• Protein Interactions: APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FGFBP2 (ARP60593_P050) antibody is Catalog # AAP60593 (Previous Catalog # AAPP46632)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FGFBP2
• Uniprot ID: Q9BYJ0
• Protein Name: Fibroblast growth factor-binding protein 2
• Protein Accession #: NP_114156
• Purification: Affinity Purified
• Nucleotide Accession #: NM_031950
• Tested Species Reactivity: Human
• Gene Symbol: FGFBP2
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-FGFBP2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Hela cell lysate