| Product Number |
ARP59151_P050 |
| Product Page |
www.avivasysbio.com/spata2-antibody-n-terminal-region-arp59151-p050.html |
| Name |
SPATA2 Antibody - N-terminal region (ARP59151_P050) |
| Protein Size (# AA) |
383 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
9825 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
spermatogenesis associated 2 |
| Alias Symbols |
PD1, tamo, PPP1R145 |
| Peptide Sequence |
Synthetic peptide located within the following region: SRVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPATA2 (ARP59151_P050) antibody |
| Blocking Peptide |
For anti-SPATA2 (ARP59151_P050) antibody is Catalog # AAP59151 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human SPATA2 |
| Uniprot ID |
Q9UM82 |
| Protein Name |
spermatogenesis-associated protein 2 |
| Protein Accession # |
NP_001129245.1 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001135773.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPATA2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HCT15
 | Host: Rabbit
Target Name: SPATA2
Sample Type: HCT15 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
