| Product Number |
ARP58649_P050 |
| Product Page |
www.avivasysbio.com/pcsk4-antibody-n-terminal-region-arp58649-p050.html |
| Name |
PCSK4 Antibody - N-terminal region (ARP58649_P050) |
| Protein Size (# AA) |
755 amino acids |
| Molecular Weight |
83kDa |
| NCBI Gene Id |
54760 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Proprotein convertase subtilisin/kexin type 4 |
| Alias Symbols |
PC4, SPC5 |
| Peptide Sequence |
Synthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Qiu,Q., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (31), 11047-11052 |
| Description of Target |
PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AC027307.5 80201-80231 c 32-257 AY358963.1 32-257 258-655 AK057235.1 452-849 656-2528 AY358963.1 656-2528 2529-2606 AL043305.1 210-287 2607-2674 AA453604.1 1-68 c |
| Protein Interactions |
IGF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PCSK4 (ARP58649_P050) antibody |
| Blocking Peptide |
For anti-PCSK4 (ARP58649_P050) antibody is Catalog # AAP58649 (Previous Catalog # AAPP35786) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PCSK4 |
| Uniprot ID |
Q6UW60 |
| Protein Name |
Proprotein convertase subtilisin/kexin type 4 |
| Protein Accession # |
NP_060043 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017573 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PCSK4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 93% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-PCSK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate |
|
|
