PCSK4 Antibody - N-terminal region (ARP58649_P050)

Data Sheet
 
Product Number ARP58649_P050
Product Page www.avivasysbio.com/pcsk4-antibody-n-terminal-region-arp58649-p050.html
Name PCSK4 Antibody - N-terminal region (ARP58649_P050)
Protein Size (# AA) 755 amino acids
Molecular Weight 83kDa
NCBI Gene Id 54760
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proprotein convertase subtilisin/kexin type 4
Alias Symbols PC4, SPC5
Peptide Sequence Synthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Qiu,Q., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (31), 11047-11052
Description of Target PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AC027307.5 80201-80231 c 32-257 AY358963.1 32-257 258-655 AK057235.1 452-849 656-2528 AY358963.1 656-2528 2529-2606 AL043305.1 210-287 2607-2674 AA453604.1 1-68 c
Protein Interactions IGF2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PCSK4 (ARP58649_P050) antibody
Blocking Peptide For anti-PCSK4 (ARP58649_P050) antibody is Catalog # AAP58649 (Previous Catalog # AAPP35786)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PCSK4
Uniprot ID Q6UW60
Protein Name Proprotein convertase subtilisin/kexin type 4
Protein Accession # NP_060043
Purification Affinity Purified
Nucleotide Accession # NM_017573
Tested Species Reactivity Human
Gene Symbol PCSK4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 93%
Image 1
Human OVCAR-3
WB Suggested Anti-PCSK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com