CAT Antibody - middle region (ARP58437_P050)

Data Sheet
 
Product Number ARP58437_P050
Product Page www.avivasysbio.com/cat-antibody-middle-region-arp58437-p050.html
Name CAT Antibody - middle region (ARP58437_P050)
Protein Size (# AA) 527 amino acids
Molecular Weight 58kDa
NCBI Gene Id 847
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Catalase
Alias Symbols MGC138422, MGC138424
Peptide Sequence Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Holt,M., (2006) J. Biol. Chem. 281 (25), 17076-17083
Description of Target This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t
Protein Interactions UBC; KEAP1; PEX5; EHHADH; CAT; STIM1; HSD17B4; APP; MECP2; SUMO4; USP53; TLR10; PTPN11; ABL2; ABL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CAT (ARP58437_P050) antibody
Blocking Peptide For anti-CAT (ARP58437_P050) antibody is Catalog # AAP58437 (Previous Catalog # AAPP34517)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CAT
Uniprot ID P04040
Protein Name Catalase
Protein Accession # NP_001743
Purification Affinity Purified
Nucleotide Accession # NM_053052
Tested Species Reactivity Human, Mouse
Gene Symbol CAT
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 93%
Image 1
Human heart
WB Suggested Anti-CAT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart
Image 2
Mouse Macrophage
Sample Type: Mouse Macrophage
Dilution: 1:100
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com