BPGM Antibody - middle region (ARP58217_P050)

Data Sheet
 
Product Number ARP58217_P050
Product Page www.avivasysbio.com/bpgm-antibody-middle-region-arp58217-p050.html
Name BPGM Antibody - middle region (ARP58217_P050)
Protein Size (# AA) 259 amino acids
Molecular Weight 28kDa
NCBI Gene Id 669
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 2,3-bisphosphoglycerate mutase
Alias Symbols DPGM, ECYT8
Peptide Sequence Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang,Y., (2006) J. Biol. Chem. 281 (51), 39642-39648
Description of Target BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Protein Interactions UBC; EHD2; ATF6; NEK3; EGR2; CEL; ATP4B; SPEN; GRB2; AKT1; GAPDH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BPGM (ARP58217_P050) antibody
Blocking Peptide For anti-BPGM (ARP58217_P050) antibody is Catalog # AAP58217 (Previous Catalog # AAPP32816)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BPGM
Uniprot ID P07738
Protein Name Bisphosphoglycerate mutase
Protein Accession # NP_001715
Purification Affinity Purified
Nucleotide Accession # NM_001724
Tested Species Reactivity Human
Gene Symbol BPGM
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%; Zebrafish: 92%
Image 1
Human Heart
WB Suggested Anti-BPGM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com