ZNF768 Antibody - N-terminal region (ARP58118_P050)

• Product Number: ARP58118_P050
• Name: ZNF768 Antibody - N-terminal region (ARP58118_P050)
• Protein Size (# AA): 540 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 79724
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 768
• Alias Symbols: FLJ23436
• Peptide Sequence: Synthetic peptide located within the following region: DSQSPEFESQSPRYEPQSPGYEPRSPGYEPRSPGYESESSRYESQNTELK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
• Description of Target: ZNF768 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
• Protein Interactions: PASK; MDC1; BARD1; UBC; TNNT1; NDUFA12; HMP19; ZNF277;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF768 (ARP58118_P050) antibody is Catalog # AAP58118 (Previous Catalog # AAPP32551)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF768
• Uniprot ID: Q9H5H4
• Protein Name: Zinc finger protein 768
• Protein Accession #: NP_078947
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024671
• Tested Species Reactivity: Human
• Gene Symbol: ZNF768
• Predicted Species Reactivity: Human, Rat, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 91%; Human: 100%; Pig: 92%; Rat: 75%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF768 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate