Product Number |
ARP58118_P050 |
Product Page |
www.avivasysbio.com/znf768-antibody-n-terminal-region-arp58118-p050.html |
Name |
ZNF768 Antibody - N-terminal region (ARP58118_P050) |
Protein Size (# AA) |
540 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
79724 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 768 |
Alias Symbols |
FLJ23436 |
Peptide Sequence |
Synthetic peptide located within the following region: DSQSPEFESQSPRYEPQSPGYEPRSPGYEPRSPGYESESSRYESQNTELK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 |
Description of Target |
ZNF768 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers. It may be involved in transcriptional regulation. |
Protein Interactions |
PASK; MDC1; BARD1; UBC; TNNT1; NDUFA12; HMP19; ZNF277; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF768 (ARP58118_P050) antibody |
Blocking Peptide |
For anti-ZNF768 (ARP58118_P050) antibody is Catalog # AAP58118 (Previous Catalog # AAPP32551) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF768 |
Uniprot ID |
Q9H5H4 |
Protein Name |
Zinc finger protein 768 |
Protein Accession # |
NP_078947 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024671 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF768 |
Predicted Species Reactivity |
Human, Rat, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 91%; Human: 100%; Pig: 92%; Rat: 75% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF768 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|