| Product Number |
ARP58040_P050 |
| Product Page |
www.avivasysbio.com/pax1-antibody-middle-region-arp58040-p050.html |
| Name |
PAX1 Antibody - middle region (ARP58040_P050) |
| Protein Size (# AA) |
440 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
5075 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paired box 1 |
| Alias Symbols |
OFC2, HUP48 |
| Peptide Sequence |
Synthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Vatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302 |
| Description of Target |
The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
MEOX2; MEOX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PAX1 (ARP58040_P050) antibody |
| Blocking Peptide |
For anti-PAX1 (ARP58040_P050) antibody is Catalog # AAP58040 (Previous Catalog # AAPP32463) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAX1 |
| Uniprot ID |
P15863 |
| Protein Name |
Paired box protein Pax-1 |
| Sample Type Confirmation |
PAX1 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_006183 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006192 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PAX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human Fetal Muscle
 | Host: Rabbit
Target Name: PAX1
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml |
| | Image 2 | Human 721_B
 | WB Suggested Anti-PAX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysatePAX1 is supported by BioGPS gene expression data to be expressed in 721_B |
|
|
