ZNF257 Antibody - N-terminal region (ARP57954_P050)

Data Sheet
 
Product Number ARP57954_P050
Product Page www.avivasysbio.com/znf257-antibody-n-terminal-region-arp57954-p050.html
Name ZNF257 Antibody - N-terminal region (ARP57954_P050)
Protein Size (# AA) 563 amino acids
Molecular Weight 66kDa
NCBI Gene Id 113835
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 257
Alias Symbols BMZF4, BMZF-4
Peptide Sequence Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748
Description of Target The function of ZNF257 has not yet been determined.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF257 (ARP57954_P050) antibody
Blocking Peptide For anti-ZNF257 (ARP57954_P050) antibody is Catalog # AAP57954 (Previous Catalog # AAPP32365)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257
Uniprot ID Q9Y2Q1
Protein Name Zinc finger protein 257
Protein Accession # NP_258429
Purification Affinity Purified
Nucleotide Accession # NM_033468
Tested Species Reactivity Human
Gene Symbol ZNF257
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF257 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com