Product Number |
ARP57954_P050 |
Product Page |
www.avivasysbio.com/znf257-antibody-n-terminal-region-arp57954-p050.html |
Name |
ZNF257 Antibody - N-terminal region (ARP57954_P050) |
Protein Size (# AA) |
563 amino acids |
Molecular Weight |
66kDa |
NCBI Gene Id |
113835 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 257 |
Alias Symbols |
BMZF4, BMZF-4 |
Peptide Sequence |
Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748 |
Description of Target |
The function of ZNF257 has not yet been determined. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF257 (ARP57954_P050) antibody |
Blocking Peptide |
For anti-ZNF257 (ARP57954_P050) antibody is Catalog # AAP57954 (Previous Catalog # AAPP32365) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257 |
Uniprot ID |
Q9Y2Q1 |
Protein Name |
Zinc finger protein 257 |
Protein Accession # |
NP_258429 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_033468 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF257 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF257 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|