| Product Number |
ARP57900_P050 |
| Product Page |
www.avivasysbio.com/ssx1-antibody-middle-region-arp57900-p050.html |
| Name |
SSX1 Antibody - middle region (ARP57900_P050) |
| Protein Size (# AA) |
188 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
6756 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Synovial sarcoma, X breakpoint 1 |
| Alias Symbols |
SSRC, CT5.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tornkvist,M., (2008) Biochem. Biophys. Res. Commun. 368 (3), 793-800 |
| Description of Target |
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo |
| Protein Interactions |
MAGEC2; LHX4; FUBP3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SSX1 (ARP57900_P050) antibody |
| Blocking Peptide |
For anti-SSX1 (ARP57900_P050) antibody is Catalog # AAP57900 (Previous Catalog # AAPP32311) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SSX1 |
| Uniprot ID |
Q16384 |
| Protein Name |
Protein SSX1 |
| Protein Accession # |
NP_005626 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005635 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SSX1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-SSX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate |
|
|
