CNOT4 Antibody - middle region (ARP57877_P050)

Data Sheet
 
Product Number ARP57877_P050
Product Page www.avivasysbio.com/cnot4-antibody-middle-region-arp57877-p050.html
Name CNOT4 Antibody - middle region (ARP57877_P050)
Protein Size (# AA) 639 amino acids
Molecular Weight 70kDa
Subunit 4
NCBI Gene Id 4850
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CCR4-NOT transcription complex, subunit 4
Alias Symbols NOT4, NOT4H, CLONE243
Peptide Sequence Synthetic peptide located within the following region: AGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFST
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Winkler,G.S., (2004) J. Mol. Biol. 337 (1), 157-165
Description of Target CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.
Protein Interactions EP300; UBE2D1; UBC5; CNOT1; UBE2E3; UBE2E1; UBE2D2; UBC; CNOT4; ELAVL1; KDM5C; UBE2W; UBE2D4; UBE2N; UBE2D3; CNOT8; UBE2B; CDC39;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CNOT4 (ARP57877_P050) antibody
Blocking Peptide For anti-CNOT4 (ARP57877_P050) antibody is Catalog # AAP57877 (Previous Catalog # AAPP32230)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CNOT4
Uniprot ID O95628
Protein Name CCR4-NOT transcription complex subunit 4
Sample Type Confirmation

CNOT4 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Protein Accession # NP_037448
Purification Affinity Purified
Nucleotide Accession # NM_013316
Tested Species Reactivity Human
Gene Symbol CNOT4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human NCI-H226
WB Suggested Anti-CNOT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysateCNOT4 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com