HOXC8 Antibody - middle region (ARP57869_P050)

Data Sheet
 
Product Number ARP57869_P050
Product Page www.avivasysbio.com/hoxc8-antibody-middle-region-arp57869-p050.html
Name HOXC8 Antibody - middle region (ARP57869_P050)
Protein Size (# AA) 242 amino acids
Molecular Weight 27kDa
NCBI Gene Id 3224
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox C8
Alias Symbols HOX3, HOX3A
Peptide Sequence Synthetic peptide located within the following region: SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kikugawa,T., (2006) Prostate 66 (10), 1092-1099
Description of Target This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
Protein Interactions UBC; PBX1; HOMEZ; GMNN; SMAD6; BTG2; SMAD1; BMPR1A; SMAD4; JUN; MSX1; DLX5; DLX2; KMT2A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXC8 (ARP57869_P050) antibody
Blocking Peptide For anti-HOXC8 (ARP57869_P050) antibody is Catalog # AAP57869 (Previous Catalog # AAPP32222)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXC8
Uniprot ID P31273
Protein Name Homeobox protein Hox-C8
Protein Accession # NP_073149
Purification Affinity Purified
Nucleotide Accession # NM_022658
Tested Species Reactivity Human
Gene Symbol HOXC8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Human THP-1
WB Suggested Anti-HOXC8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com